Class b: All beta proteins [48724] (180 folds) |
Fold b.15: HSP20-like chaperones [49763] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) |
Family b.15.1.0: automated matches [191643] (1 protein) not a true family |
Protein automated matches [191181] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [233346] (1 PDB entry) |
Domain d3qorc1: 3qor C:158-273 [239641] Other proteins in same PDB: d3qora2, d3qorb2, d3qorc2, d3qord2, d3qore2 automated match to d3qora_ complexed with act |
PDB Entry: 3qor (more details), 1.75 Å
SCOPe Domain Sequences for d3qorc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qorc1 b.15.1.0 (C:158-273) automated matches {Human (Homo sapiens) [TaxId: 9606]} klkpnlgngadlpnyrwtqtlseldlavpfcvnfrlkgkdmvvdiqrrhlrvglkgqpai idgelynevkveesswliadgavvtvhlekinkmewwsrlvssdpeintkkinpen
Timeline for d3qorc1: