Lineage for d3q8ca1 (3q8c A:226-734)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029096Fold f.60: Anthrax protective antigen C-terminal-like [254103] (1 superfamily)
    C-terminal 3 domains; II (226-487) is beta-sandwiches of gamma-crystallin like topology, similar to domain I; III (488-594) has a beta-grasp like fold; IV (595-735) has an Ig-like fold
  4. 3029097Superfamily f.60.1: Anthrax protective antigen C-terminal-like [254122] (1 family) (S)
  5. 3029098Family f.60.1.1: Anthrax protective antigen C-terminal-like [254146] (2 proteins)
  6. 3029099Protein Anthrax protective antigen C-terminal-like [254333] (1 species)
  7. 3029100Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [254762] (14 PDB entries)
  8. 3029113Domain d3q8ca1: 3q8c A:226-734 [239634]
    Other proteins in same PDB: d3q8ca2
    complexed with ca

Details for d3q8ca1

PDB Entry: 3q8c (more details), 2.85 Å

PDB Description: crystal structure of protective antigen w346f (ph 5.5)
PDB Compounds: (A:) Protective antigen

SCOPe Domain Sequences for d3q8ca1:

Sequence, based on SEQRES records: (download)

>d3q8ca1 f.60.1.1 (A:226-734) Anthrax protective antigen C-terminal-like {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
wstasdpysdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsq
trtiskntstsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagert
faetmglntadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqil
apnnyypsknlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfe
ngrvrvdtgsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlke
alkiafgfnepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklna
kmnilirdkrfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyive
iedteglkevindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtken
tiinpsengdtstngikkilifskkgyei

Sequence, based on observed residues (ATOM records): (download)

>d3q8ca1 f.60.1.1 (A:226-734) Anthrax protective antigen C-terminal-like {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
wstasdpysdfekvtgridknvspearhplvaaypivhvdmeniilsknedqsntdsqtr
tiskntstsrthtssagfsnsnsstvaidhsllntadtarlnaniryvntgtapiynvlp
ttslvlgknqtlatikakenqlsqilapnnyypsknlapialnaqddfsstpitmnynqf
lelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlpqiqettariifngkdln
lverriaavnpsdplettkpdmtlkealkiafgfnepngnlqyqgkditefdfnfdqqts
qniknqlaelnatniytvldkiklnakmnilirdkrfhydrnniavgadesvvkeahrev
inssteglllnidkdirkilsgyiveiedteglkevindrydmlnisslrqdgktfidfk
kyndklplyisnpnykvnvyavtkentiinpsengdtstngikkilifskkgyei

SCOPe Domain Coordinates for d3q8ca1:

Click to download the PDB-style file with coordinates for d3q8ca1.
(The format of our PDB-style files is described here.)

Timeline for d3q8ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q8ca2