SCOPe 2.01: Domain d1cvnd_: 1cvn D:

Lineage for d1cvnd_ (1cvn D:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Concanavalin A [49901] (3 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop

7. Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (51 PDB entries)
   Uniprot P81461

8. Domain d1cvnd_: 1cvn D: [23958]
   complexed with ca, mn

Details for d1cvnd_

PDB Entry: 1cvn, 2.3 Å

PDB Description: concanavalin a complexed to trimannoside

PDB Compounds: (D:) concanavalin a

SCOPe Domain Sequences for d1cvnd_:

Sequence; same for both SEQRES and ATOM records:

>d1cvnd_ b.29.1.1 (D:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d1cvnd_:

• d1cvnd_ first appeared (with stable ids) in SCOP 1.55
  
• d1cvnd_ appears in SCOP 1.75
  
• d1cvnd_ appears in SCOPe 2.02
  
• d1cvnd_ appears in the current release, SCOPe 2.08