Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein automated matches [190888] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188282] (27 PDB entries) |
Domain d3ncbb1: 3ncb B:1-100 [239490] Other proteins in same PDB: d3ncba_ automated match to d3mzgb1 complexed with cl, co3, na; mutant |
PDB Entry: 3ncb (more details), 2.1 Å
SCOPe Domain Sequences for d3ncbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ncbb1 b.1.2.1 (B:1-100) automated matches {Human (Homo sapiens) [TaxId: 9606]} mlppgkpeifkcrspnketftcwwrpgtdgglptnysltyhregetlmhecpdyitggpn schfgkqytsmwrtyimmvnatnqmgssfsdelyvdvtyi
Timeline for d3ncbb1: