Lineage for d3ii6a2 (3ii6 A:118-201)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1969071Superfamily h.1.11: XRCC4, C-terminal oligomerization domain [58022] (1 family) (S)
  5. 1969072Family h.1.11.1: XRCC4, C-terminal oligomerization domain [58023] (1 protein)
  6. 1969073Protein XRCC4, C-terminal oligomerization domain [58024] (1 species)
  7. 1969074Species Human (Homo sapiens) [TaxId:9606] [58025] (3 PDB entries)
  8. 1969079Domain d3ii6a2: 3ii6 A:118-201 [239353]
    Other proteins in same PDB: d3ii6a1, d3ii6b1, d3ii6c1, d3ii6d1
    protein/DNA complex; complexed with cl

Details for d3ii6a2

PDB Entry: 3ii6 (more details), 2.4 Å

PDB Description: structure of human xrcc4 in complex with the tandem brct domains of dna ligaseiv.
PDB Compounds: (A:) DNA repair protein xrcc4

SCOPe Domain Sequences for d3ii6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ii6a2 h.1.11.1 (A:118-201) XRCC4, C-terminal oligomerization domain {Human (Homo sapiens) [TaxId: 9606]}
npaevirelicycldttaenqaknehlqkenerllrdwndvqgrfekcvsakealetdly
krfilvlnekktkirslhnkllna

SCOPe Domain Coordinates for d3ii6a2:

Click to download the PDB-style file with coordinates for d3ii6a2.
(The format of our PDB-style files is described here.)

Timeline for d3ii6a2: