Lineage for d3hdap2 (3hda P:61-258)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1917692Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 1917693Protein Metalloprotease [55509] (4 species)
    the rest of protein is all-beta sandwich containing a parallel beta-helix
  7. 1917694Species Erwinia chrysanthemi [TaxId:556] [82735] (9 PDB entries)
    Protease C
  8. 1917703Domain d3hdap2: 3hda P:61-258 [239339]
    Other proteins in same PDB: d3hdap1
    complexed with ca, cl; mutant

Details for d3hdap2

PDB Entry: 3hda (more details), 2.13 Å

PDB Description: prtc methionine mutants: m226a_desy
PDB Compounds: (P:) secreted protease C

SCOPe Domain Sequences for d3hdap2:

Sequence, based on SEQRES records: (download)

>d3hdap2 d.92.1.6 (P:61-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]}
nvswngtnvfgksanltfkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltf
tevtgnksanitfgnytrdasgnldygtqayayypgnyqgagsswynynqsnirnpgsee
ygrqtftheighalglahpgeynagegdpsyndavyaedsyqfsiasywgenetgadyng
hyggapmiddiaaiqrly

Sequence, based on observed residues (ATOM records): (download)

>d3hdap2 d.92.1.6 (P:61-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]}
nvswngtnvfgksanltfkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltf
tevtgnksanitfgnytrdasgnldygtqayayypgnyqgagsswynynqsnirnpgsee
ygrqtftheighalglahpgynghyggapmiddiaaiqrly

SCOPe Domain Coordinates for d3hdap2:

Click to download the PDB-style file with coordinates for d3hdap2.
(The format of our PDB-style files is described here.)

Timeline for d3hdap2: