Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins) characteristic HEXXHXXGXXH motif and Met located near C-terminus |
Protein Metalloprotease [55509] (4 species) the rest of protein is all-beta sandwich containing a parallel beta-helix |
Species Erwinia chrysanthemi [TaxId:556] [82735] (9 PDB entries) Protease C |
Domain d3hdap2: 3hda P:61-258 [239339] Other proteins in same PDB: d3hdap1 complexed with ca, cl; mutant |
PDB Entry: 3hda (more details), 2.13 Å
SCOPe Domain Sequences for d3hdap2:
Sequence, based on SEQRES records: (download)
>d3hdap2 d.92.1.6 (P:61-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} nvswngtnvfgksanltfkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltf tevtgnksanitfgnytrdasgnldygtqayayypgnyqgagsswynynqsnirnpgsee ygrqtftheighalglahpgeynagegdpsyndavyaedsyqfsiasywgenetgadyng hyggapmiddiaaiqrly
>d3hdap2 d.92.1.6 (P:61-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} nvswngtnvfgksanltfkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltf tevtgnksanitfgnytrdasgnldygtqayayypgnyqgagsswynynqsnirnpgsee ygrqtftheighalglahpgynghyggapmiddiaaiqrly
Timeline for d3hdap2: