SCOPe 2.01: Domain d1qu5a_: 1qu5 A:

Lineage for d1qu5a_ (1qu5 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.2: FHA domain [49885] (12 proteins)

6. Protein Phosphotyrosine binding domain of Rad53 [49886] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49887] (18 PDB entries)

8. Domain d1qu5a_: 1qu5 A: [23922]

Details for d1qu5a_

PDB Entry: 1qu5

PDB Description: nmr structure of a new phosphotyrosine binding domain containing the fha2 domain of rad 53

PDB Compounds: (A:) protein kinase spk1

SCOPe Domain Sequences for d1qu5a_:

Sequence; same for both SEQRES and ATOM records:

>d1qu5a_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eaetreqkllhsnntenvksskkkgngrfltlkplpdsiiqesleiqqgvnpffigrsed
cnckiednrlsrvhcfifkkrhavgksmyespaqglddiwychtgtnvsylnnnrmiqgt
kfllqdgdeikiiwdknnkfvigfkveindttglfneglgmlqeqrvvlkqtaeekdlvk
kl

Timeline for d1qu5a_:

• d1qu5a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qu5a_ appears in SCOP 1.75
  
• d1qu5a_ appears in SCOPe 2.02
  
• d1qu5a_ appears in the current release, SCOPe 2.08