Class b: All beta proteins [48724] (110 folds) |
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) |
Superfamily b.26.1: SMAD/FHA domain [49879] (2 families) |
Family b.26.1.2: FHA domain [49885] (1 protein) |
Protein Phosphotyrosine binding domain of Rad53 [49886] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49887] (16 PDB entries) |
Domain d1fhqa_: 1fhq A: [23919] |
PDB Entry: 1fhq (more details)
SCOP Domain Sequences for d1fhqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fhqa_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae)} gngrfltlkplpdsiiqesleiqqgvnpffigrsedcnckiednrlsrvhcfifkkrhav gksmyespaqglddiwychtgtnvsylnnnrmiqgtkfllqdgdeikiiwdknnkfvigf kveindttglfneglgmlqeqrvvlkqtaeekdlvkkl
Timeline for d1fhqa_: