Lineage for d1fhqa_ (1fhq A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) Superfamily b.26.1: SMAD/FHA domain [49879] (2 families) 
Family b.26.1.2: FHA domain [49885] (1 protein) Protein Phosphotyrosine binding domain of Rad53 [49886] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49887] (16 PDB entries) 
Domain d1fhqa_: 1fhq A: [23919]
Details for d1fhqa_
PDB Entry: 1fhq (more details)
PDB Description: refined solution structure of the fha2 domain of rad53
SCOP Domain Sequences for d1fhqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fhqa_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae)}
gngrfltlkplpdsiiqesleiqqgvnpffigrsedcnckiednrlsrvhcfifkkrhav
gksmyespaqglddiwychtgtnvsylnnnrmiqgtkfllqdgdeikiiwdknnkfvigf
kveindttglfneglgmlqeqrvvlkqtaeekdlvkkl
SCOP Domain Coordinates for d1fhqa_:
Click to download the PDB-style file with coordinates for d1fhqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fhqa_:
- d1fhqa_ first appeared (with stable ids) in SCOP 1.55
- d1fhqa_ appears in SCOP 1.57
- d1fhqa_ appears in SCOP 1.61
- d1fhqa_ appears in the current release, SCOPe 2.08
View in 3D