SCOPe 2.04: Domain d3a8jc1: 3a8j C:1-276

Lineage for d3a8jc1 (3a8j C:1-276)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.250: Folate-binding domain [103024] (1 superfamily)
   duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands

4. Superfamily d.250.1: Folate-binding domain [103025] (2 families)
   some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase

5. Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins)

6. Protein automated matches [231765] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [231766] (3 PDB entries)

8. Domain d3a8jc1: 3a8j C:1-276 [239090]
   Other proteins in same PDB: d3a8ja2, d3a8jb2, d3a8jc2, d3a8jd2, d3a8je_, d3a8jf_
   automated match to d3a8ia1

Details for d3a8jc1

PDB Entry: 3a8j, 1.98 Å

PDB Description: Crystal Structure of ET-EHred complex

PDB Compounds: (C:) Aminomethyltransferase

SCOPe Domain Sequences for d3a8jc1:

Sequence; same for both SEQRES and ATOM records:

>d3a8jc1 d.250.1.1 (C:1-276) automated matches {Escherichia coli K-12 [TaxId: 83333]}
aqqtplyeqhtlcgarmvdfhgwmmplhygsqidehhavrtdagmfdvshmtivdlrgsr
treflryllandvakltksgkalysgmlnasggviddlivyyftedffrlvvnsatrekd
lswitqhaepfgieitvrddlsmiavqgpnaqakaatlfndaqrqavegmkpffgvqagd
lfiattgytgeagyeialpnekaadfwralveagvkpcglgardtlrleagmnlygqemd
etisplaanmgwtiawepadrdfigrealevqrehg

Timeline for d3a8jc1:

• d3a8jc1 is new in SCOPe 2.04-stable
  
• d3a8jc1 appears in SCOPe 2.05
  
• d3a8jc1 appears in the current release, SCOPe 2.08