SCOP 1.71: Domain d1thv__: 1thv -

Lineage for d1thv__ (1thv -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (4 proteins)

6. Protein Thaumatin [49876] (1 species)

7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (11 PDB entries)

8. Domain d1thv__: 1thv - [23904]

Details for d1thv__

PDB Entry: 1thv, 1.75 Å

PDB Description: the structures of three crystal forms of the sweet protein thaumatin

SCOP Domain Sequences for d1thv__:

Sequence; same for both SEQRES and ATOM records:

>d1thv__ b.25.1.1 (-) Thaumatin {Ketemfe (Thaumatococcus daniellii)}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

Timeline for d1thv__:

• d1thv__ first appeared (with stable ids) in SCOP 1.55
  
• d1thv__ appears in SCOP 1.69
  
• d1thv__ is called d1thva_ in SCOP 1.73
  
• d1thv__ appears in the current release, SCOPe 2.08, called d1thva_