Lineage for d1thv__ (1thv -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12333Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
  4. 12334Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family) (S)
  5. 12335Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (3 proteins)
  6. 12339Protein Thaumatin [49876] (1 species)
  7. 12340Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (4 PDB entries)
  8. 12342Domain d1thv__: 1thv - [23904]

Details for d1thv__

PDB Entry: 1thv (more details), 1.75 Å

PDB Description: the structures of three crystal forms of the sweet protein thaumatin

SCOP Domain Sequences for d1thv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1thv__ b.25.1.1 (-) Thaumatin {Ketemfe (Thaumatococcus daniellii)}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOP Domain Coordinates for d1thv__:

Click to download the PDB-style file with coordinates for d1thv__.
(The format of our PDB-style files is described here.)

Timeline for d1thv__: