Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (2 families) |
Family h.1.3.1: Leucine zipper domain [57960] (17 proteins) |
Protein GCN4 [57961] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (65 PDB entries) Uniprot P03069 249-279 ! Uniprot P03069 249-281 |
Domain d2r2ve_: 2r2v E: [238846] automated match to d2ccna1 complexed with act, cit, zn |
PDB Entry: 2r2v (more details), 1.9 Å
SCOPe Domain Sequences for d2r2ve_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r2ve_ h.1.3.1 (E:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mklkqvadkleevasklyhnanelarvakll
Timeline for d2r2ve_: