Lineage for d2ppbe_ (2ppb E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017141Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2017142Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2017143Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 2017144Protein RNA polymerase omega subunit [63564] (3 species)
  7. 2017149Species Thermus thermophilus HB8 [TaxId:300852] [158241] (6 PDB entries)
  8. 2017158Domain d2ppbe_: 2ppb E: [238812]
    Other proteins in same PDB: d2ppbc_, d2ppbd_, d2ppbm_, d2ppbn_
    automated match to d1i6ve_
    protein/DNA complex; protein/RNA complex; complexed with apc, mg, std, zn

Details for d2ppbe_

PDB Entry: 2ppb (more details), 3 Å

PDB Description: Crystal structure of the T. thermophilus RNAP polymerase elongation complex with the ntp substrate analog and antibiotic streptolydigin
PDB Compounds: (E:) DNA-directed RNA polymerase omega chain

SCOPe Domain Sequences for d2ppbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ppbe_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus thermophilus HB8 [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypve

SCOPe Domain Coordinates for d2ppbe_:

Click to download the PDB-style file with coordinates for d2ppbe_.
(The format of our PDB-style files is described here.)

Timeline for d2ppbe_: