![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
![]() | Protein automated matches [190457] (10 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries) |
![]() | Domain d2k6da_: 2k6d A: [238763] Other proteins in same PDB: d2k6db2, d2k6db3 automated match to d2ydla_ |
PDB Entry: 2k6d (more details)
SCOPe Domain Sequences for d2k6da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k6da_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kskdyckvifpyeaqnddeltikegdivtlinkdcidvgwwegelngrrgvfpdnfvkll pp
Timeline for d2k6da_: