Lineage for d2k6da_ (2k6d A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783437Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)
  8. 2783563Domain d2k6da_: 2k6d A: [238763]
    Other proteins in same PDB: d2k6db2, d2k6db3
    automated match to d2ydla_

Details for d2k6da_

PDB Entry: 2k6d (more details)

PDB Description: cin85 sh3-c domain in complex with ubiquitin
PDB Compounds: (A:) SH3 domain-containing kinase-binding protein 1

SCOPe Domain Sequences for d2k6da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k6da_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kskdyckvifpyeaqnddeltikegdivtlinkdcidvgwwegelngrrgvfpdnfvkll
pp

SCOPe Domain Coordinates for d2k6da_:

Click to download the PDB-style file with coordinates for d2k6da_.
(The format of our PDB-style files is described here.)

Timeline for d2k6da_: