![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin [54238] (9 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries) Uniprot P62988 identical sequence in many other species |
![]() | Domain d2k6db2: 2k6d B:1-75 [148276] Other proteins in same PDB: d2k6da_, d2k6db3 automated match to d3rula_ |
PDB Entry: 2k6d (more details)
SCOPe Domain Sequences for d2k6db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k6db2 d.15.1.1 (B:1-75) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrg
Timeline for d2k6db2: