Lineage for d2e43b_ (2e43 B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2265698Superfamily h.1.3: Leucine zipper domain [57959] (2 families) (S)
  5. 2265699Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)
  6. 2265730Protein C/ebp beta [57985] (2 species)
  7. 2265731Species Human (Homo sapiens) [TaxId:9606] [64590] (10 PDB entries)
  8. 2265737Domain d2e43b_: 2e43 B: [238637]
    automated match to d1h88b_
    protein/DNA complex; mutant

Details for d2e43b_

PDB Entry: 2e43 (more details), 2.1 Å

PDB Description: crystal structure of c/ebpbeta bzip homodimer k269a mutant bound to a high affinity dna fragment
PDB Compounds: (B:) CCAAT/enhancer-binding protein beta

SCOPe Domain Sequences for d2e43b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e43b_ h.1.3.1 (B:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]}
sdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnl
fkql

SCOPe Domain Coordinates for d2e43b_:

Click to download the PDB-style file with coordinates for d2e43b_.
(The format of our PDB-style files is described here.)

Timeline for d2e43b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2e43a_