|  | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) | 
|  | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold | 
|  | Superfamily d.166.1: ADP-ribosylation [56399] (8 families)  | 
|  | Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) | 
|  | Protein automated matches [190133] (5 species) not a true protein | 
|  | Species Clostridium botulinum [TaxId:1491] [187018] (9 PDB entries) | 
|  | Domain d2bovb_: 2bov B: [238622] Other proteins in same PDB: d2bova_ automated match to d1g24a_ complexed with gdp, mg | 
PDB Entry: 2bov (more details), 2.66 Å
SCOPe Domain Sequences for d2bovb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bovb_ d.166.1.1 (B:) automated matches {Clostridium botulinum [TaxId: 1491]}
ntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsn
likqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfl
nkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhsty
hiddmrlssdgkqiiitatmmgtainpk
Timeline for d2bovb_: