Lineage for d2assa2 (2ass A:1085-1160)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752264Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 1752265Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 1752266Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 1752273Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)
  7. 1752274Species Human (Homo sapiens) [TaxId:9606] [81376] (9 PDB entries)
  8. 1752279Domain d2assa2: 2ass A:1085-1160 [238619]
    Other proteins in same PDB: d2assa1, d2assb1, d2assb2, d2assc_
    automated match to d1fqvb1
    complexed with ben, po4

Details for d2assa2

PDB Entry: 2ass (more details), 3 Å

PDB Description: crystal structure of the skp1-skp2-cks1 complex
PDB Compounds: (A:) S-phase kinase-associated protein 1A

SCOPe Domain Sequences for d2assa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2assa2 a.157.1.1 (A:1085-1160) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrkenqwc

SCOPe Domain Coordinates for d2assa2:

Click to download the PDB-style file with coordinates for d2assa2.
(The format of our PDB-style files is described here.)

Timeline for d2assa2: