Lineage for d1nobe_ (1nob E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1306222Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 1306223Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 1306224Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 1306225Protein Adenovirus fiber protein "knob" domain [49837] (8 species)
  7. 1306243Species Human adenovirus type 12 [TaxId:28282] [49840] (4 PDB entries)
  8. 1306250Domain d1nobe_: 1nob E: [23854]

Details for d1nobe_

PDB Entry: 1nob (more details), 2.6 Å

PDB Description: knob domain from adenovirus serotype 12
PDB Compounds: (E:) protein (fiber knob protein)

SCOPe Domain Sequences for d1nobe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nobe_ b.21.1.1 (E:) Adenovirus fiber protein "knob" domain {Human adenovirus type 12 [TaxId: 28282]}
tpydpltlwttpdpppncsliqeldakltlcltkngsivngivslvgvkgnllniqsttt
tvgvhlvfdeqgrlitstptalvpqaswgyrqgqsvstntvtnglgfmpnvsayprpnas
eaksqmvsltylqgdtskpitmkvafngitslngysltfmwsglsnyinqpfstpscsfs
yitqe

SCOPe Domain Coordinates for d1nobe_:

Click to download the PDB-style file with coordinates for d1nobe_.
(The format of our PDB-style files is described here.)

Timeline for d1nobe_: