Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
Protein automated matches [190296] (11 species) not a true protein |
Species Bacillus anthracis [TaxId:198094] [238505] (1 PDB entry) |
Domain d4pz0a_: 4pz0 A: [238506] automated match to d1tm2a_ complexed with cl, edo, pav |
PDB Entry: 4pz0 (more details), 1.25 Å
SCOPe Domain Sequences for d4pz0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pz0a_ c.93.1.1 (A:) automated matches {Bacillus anthracis [TaxId: 198094]} dkkkaddvkfafipkltgvgfftsggegakemgdklgvqvkydgpseasvsgqvkyinnf inqnydalmvsstsvdglsqslqrakkkgmtvltwdsdvnpkdrsfyisqgtpdqlanll iemtskqigdkgkvaffyssptvtdqnqwvtkakeiikekypnweivttqygennaqksl svgenilktypdinavicpdatalpamaqaaenlkmdkkvvvtgfstpnvmrdyvkrgtv qqfglwdvkqqgalatyvaneivvkgkklkvgdsfevkgigkvkvepnsiqgydyeaegn giivlpervvftkdnidkynf
Timeline for d4pz0a_: