Lineage for d4p8sa_ (4p8s A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459922Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2459991Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2460208Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2460209Protein automated matches [190787] (14 species)
    not a true protein
  7. 2460288Species Norway rat (Rattus norvegicus) [TaxId:10116] [238487] (2 PDB entries)
  8. 2460289Domain d4p8sa_: 4p8s A: [238488]
    automated match to d1p8ta_
    complexed with ndg

Details for d4p8sa_

PDB Entry: 4p8s (more details), 1.8 Å

PDB Description: crystal structure of nogo-receptor-2
PDB Compounds: (A:) Reticulon-4 receptor-like 2

SCOPe Domain Sequences for d4p8sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p8sa_ c.10.2.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pscpmlctcysspptvscqannfssvplslppstqrlflqnnlirslrpgtfgpnlltlw
lfsnnlstiypgtfrhlqaleeldlgdnrhlrslepdtfqglerlqslhlyrcqlsslpg
nifrglvslqylylqensllhlqddlfadlanlshlflhgnrlrlltehvfrglgsldrl
llhgnrlqgvhraafhglsrltilylfnnslaslpgealadlpaleflrlnanpwacdcr
arplwawfqrarvsssdvtcatpperqgrdlrtlrdtdfqac

SCOPe Domain Coordinates for d4p8sa_:

Click to download the PDB-style file with coordinates for d4p8sa_.
(The format of our PDB-style files is described here.)

Timeline for d4p8sa_: