Class a: All alpha proteins [46456] (285 folds) |
Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) automatically mapped to Pfam PF02885 |
Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins) |
Protein Thymidine phosphorylase [47650] (2 species) |
Species Escherichia coli [TaxId:562] [47651] (7 PDB entries) |
Domain d4lhma1: 4lhm A:1-70 [238426] Other proteins in same PDB: d4lhma2, d4lhma3 automated match to d2tpta1 complexed with azz, gol, so4 |
PDB Entry: 4lhm (more details), 1.52 Å
SCOPe Domain Sequences for d4lhma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lhma1 a.46.2.1 (A:1-70) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} lflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt mamrdsgtvl
Timeline for d4lhma1: