Lineage for d4k1zc_ (4k1z C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (27 species)
    not a true protein
  7. 2042792Species Canavalia boliviana [TaxId:232300] [238384] (3 PDB entries)
  8. 2042796Domain d4k1zc_: 4k1z C: [238386]
    automated match to d4i30a_
    complexed with ca, cd, cl, mn

Details for d4k1zc_

PDB Entry: 4k1z (more details), 2.3 Å

PDB Description: Crystal structure of Canavalia boliviana lectin in complex with Man1-4Man-OMe
PDB Compounds: (C:) Canavalia boliviana lectin

SCOPe Domain Sequences for d4k1zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k1zc_ b.29.1.1 (C:) automated matches {Canavalia boliviana [TaxId: 232300]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsattglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgrdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d4k1zc_:

Click to download the PDB-style file with coordinates for d4k1zc_.
(The format of our PDB-style files is described here.)

Timeline for d4k1zc_: