| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.1: Legume lectins [49900] (5 proteins) |
| Protein automated matches [190035] (28 species) not a true protein |
| Species Canavalia boliviana [TaxId:232300] [238384] (3 PDB entries) |
| Domain d4k1zd_: 4k1z D: [238388] automated match to d4i30a_ complexed with ca, cd, cl, mn |
PDB Entry: 4k1z (more details), 2.3 Å
SCOPe Domain Sequences for d4k1zd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k1zd_ b.29.1.1 (D:) automated matches {Canavalia boliviana [TaxId: 232300]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsattglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgrdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan
Timeline for d4k1zd_: