Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.14: RNA helicase [52724] (7 proteins) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
Protein HCV helicase domain, C-terminal domain [418963] (1 species) |
Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [419425] (15 PDB entries) |
Domain d4ok6b2: 4ok6 B:326-627 [238289] Other proteins in same PDB: d4ok6a1, d4ok6b1 automated match to d4ojqa2 complexed with 2t7, ca has additional subdomain(s) that are not in the common domain |
PDB Entry: 4ok6 (more details), 2.4 Å
SCOPe Domain Sequences for d4ok6b2:
Sequence, based on SEQRES records: (download)
>d4ok6b2 c.37.1.14 (B:326-627) HCV helicase domain, C-terminal domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} pgsvtvshpnieevalsttgeipfygkaiplevikggrhlifchskkkcdelaaklvalg inavayyrgldvsviptngdvvvvstdalmtgftgdfdsvidcntcvtqtvdfsldptft ietttlpqdavsrtqrrgrtgrgkpgiyrfvapgerpsgmfdssvlcecydagcawyelm paettvrlraymntpglpvcqdhlefwegvftglthidahflsqtkqsgenfpylvayqa tvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlthpitkyimtcmsa dl
>d4ok6b2 c.37.1.14 (B:326-627) HCV helicase domain, C-terminal domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} pgsvtvshpnieevalsttgeipfygkaiplevikggrhlifchskkkcdelaaklvalg inavayyrgldvsviptngdvvvvstdalgdfdsvidcntcvtqtvdfsldptftiettt lpqdavsrtqrrgrtgrgkpgiyrfvapgerpsgmfdssvlcecydagcawyelmpaett vrlraymntpglpvcqdhlefwegvftglthidahflsqtkqsgenfpylvayqatvcar aqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlthpitkyimtcmsadl
Timeline for d4ok6b2: