Lineage for d4ok6b1 (4ok6 B:187-325)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478565Family c.37.1.14: RNA helicase [52724] (4 proteins)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2478576Protein HCV helicase domain [52725] (1 species)
  7. 2478577Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (17 PDB entries)
  8. 2478606Domain d4ok6b1: 4ok6 B:187-325 [238288]
    automated match to d4ojqa1
    complexed with 2t7, ca

Details for d4ok6b1

PDB Entry: 4ok6 (more details), 2.4 Å

PDB Description: Crystal Structure of Hepatitis C Virus NS3 Helicase Inhibitor Co-complex with Compound 13 [[1-(2-methoxy-5-nitrobenzyl)-1H-indol-3-yl]acetic acid]
PDB Compounds: (B:) Serine protease NS3

SCOPe Domain Sequences for d4ok6b1:

Sequence, based on SEQRES records: (download)

>d4ok6b1 c.37.1.14 (B:187-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
nssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskah
gvdpnirtgvrtittgspitystygkfladggcsggaydiiicdechstdatsilgigtv
ldqaetagarlvvlatatp

Sequence, based on observed residues (ATOM records): (download)

>d4ok6b1 c.37.1.14 (B:187-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
nssppavpqsfqvahlhapttkvpaayaaqgykvlvlnpsvaatlgfgaymskahspity
stygkfladggcsggaydiiicdechstdatsilgigtvldqaetagarlvvlatatp

SCOPe Domain Coordinates for d4ok6b1:

Click to download the PDB-style file with coordinates for d4ok6b1.
(The format of our PDB-style files is described here.)

Timeline for d4ok6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ok6b2
View in 3D
Domains from other chains:
(mouse over for more information)
d4ok6a1