Class b: All beta proteins [48724] (141 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (3 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (1 protein) |
Protein Hemagglutinin [49824] (1 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (36 PDB entries) |
Domain d1hgge_: 1hgg E: [23811] Other proteins in same PDB: d1hggb_, d1hggd_, d1hggf_ complexed with gal, glc, man, nag, nan |
PDB Entry: 1hgg (more details), 2.9 Å
SCOP Domain Sequences for d1hgge_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hgge_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains} qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki tygacpkyvkqntlklatgmrnvpekqt
Timeline for d1hgge_: