SCOP 1.67: Domain d1hggc_: 1hgg C:

Lineage for d1hggc_ (1hgg C:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (3 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (1 protein)

6. Protein Hemagglutinin [49824] (1 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (36 PDB entries)

8. Domain d1hggc_: 1hgg C: [23810]
   Other proteins in same PDB: d1hggb_, d1hggd_, d1hggf_

Details for d1hggc_

PDB Entry: 1hgg, 2.9 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

SCOP Domain Sequences for d1hggc_:

Sequence; same for both SEQRES and ATOM records:

>d1hggc_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

Timeline for d1hggc_:

• d1hggc_ first appeared (with stable ids) in SCOP 1.55
  
• d1hggc_ appears in SCOP 1.65
  
• d1hggc_ appears in SCOP 1.69
  
• d1hggc_ appears in the current release, SCOPe 2.08