Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily) complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354 |
Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families) automatically mapped to Pfam PF02511 |
Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins) |
Protein Thy1 homologue [69798] (1 species) |
Species Thermotoga maritima [TaxId:2336] [69799] (25 PDB entries) TM0449 |
Domain d4katb1: 4kat B:1-219 [237961] Other proteins in same PDB: d4kata2, d4katb2, d4katd2 automated match to d4gtlc_ complexed with du, fda; mutant |
PDB Entry: 4kat (more details), 2.14 Å
SCOPe Domain Sequences for d4katb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4katb1 d.207.1.1 (B:1-219) Thy1 homologue {Thermotoga maritima [TaxId: 2336]} mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlkadshaq weiqqyalaiarifkekcpwtfeaflkyaykgdilkevq
Timeline for d4katb1: