Lineage for d4katb1 (4kat B:1-219)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238756Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 2238757Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families) (S)
    automatically mapped to Pfam PF02511
  5. 2238758Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)
  6. 2238759Protein Thy1 homologue [69798] (1 species)
  7. 2238760Species Thermotoga maritima [TaxId:2336] [69799] (25 PDB entries)
    TM0449
  8. 2238830Domain d4katb1: 4kat B:1-219 [237961]
    Other proteins in same PDB: d4kata2, d4katb2, d4katd2
    automated match to d4gtlc_
    complexed with du, fda; mutant

Details for d4katb1

PDB Entry: 4kat (more details), 2.14 Å

PDB Description: Crystal structure of FDTS from T. maritima mutant (R174K) with FAD and dUMP
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d4katb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4katb1 d.207.1.1 (B:1-219) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlkadshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkevq

SCOPe Domain Coordinates for d4katb1:

Click to download the PDB-style file with coordinates for d4katb1.
(The format of our PDB-style files is described here.)

Timeline for d4katb1: