Lineage for d1ahsb_ (1ahs B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370579Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 370580Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 370581Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins)
    this domain is inserted into a multihelical domain
  6. 370603Protein RDV p8, central (top) domain [100924] (2 species)
  7. 370604Species African horse sickness virus [TaxId:40050] [49822] (1 PDB entry)
  8. 370606Domain d1ahsb_: 1ahs B: [23795]

Details for d1ahsb_

PDB Entry: 1ahs (more details), 2.3 Å

PDB Description: crystal structure of the top domain of african horse sickness virus vp7

SCOP Domain Sequences for d1ahsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahsb_ b.19.1.1 (B:) RDV p8, central (top) domain {African horse sickness virus}
tgpyagavevqqsgryyvpqgrtrggyinsniaevcmdagaagqvnallaprrgdavmiy
fvwrplrifcdpqgaslesapgtfvtvdgvnvaagdvvawntiapvnvgnpgarrsilqf
evlwyt

SCOP Domain Coordinates for d1ahsb_:

Click to download the PDB-style file with coordinates for d1ahsb_.
(The format of our PDB-style files is described here.)

Timeline for d1ahsb_: