SCOPe 2.08: Domain d4je6b1: 4je6 B:3-190

Lineage for d4je6b1 (4je6 B:3-190)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (20 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [230479] (5 PDB entries)

8. Domain d4je6b1: 4je6 B:3-190 [237948]
   Other proteins in same PDB: d4je6a2, d4je6b2
   automated match to d4je7a_
   complexed with zn

Details for d4je6b1

PDB Entry: 4je6, 2 Å

PDB Description: Crystal structure of a human-like mitochondrial peptide deformylase

PDB Compounds: (B:) Peptide deformylase 1A, chloroplastic/mitochondrial

SCOPe Domain Sequences for d4je6b1:

Sequence; same for both SEQRES and ATOM records:

>d4je6b1 d.167.1.0 (B:3-190) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lpeivasgdpvlhekarevdpgeigseriqkiiddmikvmrlapcvglaapqigvplrii
vledtkeyisyapkeeilaqerrhfdlmvmvnpvlkersnkkalffegcesvdgfraave
rylevvvtgydrqgkrievnasgwqarilqhecdhldgnlyvdkmvprtfrtvdnldlpl
aegcpklg

Timeline for d4je6b1:

• d4je6b1 first appeared in SCOPe 2.03, called d4je6b_
  
• d4je6b1 appears in SCOPe 2.07