Lineage for d2btvt2 (2btv T:121-254)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164168Fold b.19: Viral protein domain [49817] (1 superfamily)
  4. 164169Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
  5. 164170Family b.19.1.1: Top domain of virus capsid protein [49819] (2 proteins)
  6. 164171Protein Virus capsid protein vp7 (BTV-10 vp7), central (top) domain [49820] (2 species)
  7. 164176Species Bluetongue virus [TaxId:40051] [49821] (2 PDB entries)
  8. 164195Domain d2btvt2: 2btv T:121-254 [23793]
    Other proteins in same PDB: d2btva_, d2btvb_, d2btvc1, d2btvd1, d2btve1, d2btvf1, d2btvg1, d2btvh1, d2btvi1, d2btvj1, d2btvp1, d2btvq1, d2btvr1, d2btvs1, d2btvt1

Details for d2btvt2

PDB Entry: 2btv (more details), 3.5 Å

PDB Description: atomic model for bluetongue virus (btv) core

SCOP Domain Sequences for d2btvt2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btvt2 b.19.1.1 (T:121-254) Virus capsid protein vp7 (BTV-10 vp7), central (top) domain {Bluetongue virus}
parqpygffleteetfqpgrwfmraaqaatavvcgpdmiqvslnagargdvqqifqgrnd
pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvrnptqqn
amvqiqvvfyismd

SCOP Domain Coordinates for d2btvt2:

Click to download the PDB-style file with coordinates for d2btvt2.
(The format of our PDB-style files is described here.)

Timeline for d2btvt2: