Lineage for d3wp6a_ (3wp6 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390859Species Neocallimastix patriciarum [TaxId:4758] [237916] (5 PDB entries)
  8. 2390860Domain d3wp6a_: 3wp6 A: [237918]
    automated match to d1igoa_
    complexed with bxp

Details for d3wp6a_

PDB Entry: 3wp6 (more details), 1.43 Å

PDB Description: the complex structure of cdbfv e109a with xylotriose
PDB Compounds: (A:) cdbfv

SCOPe Domain Sequences for d3wp6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wp6a_ b.29.1.0 (A:) automated matches {Neocallimastix patriciarum [TaxId: 4758]}
aefqsfcssashsgqsvkvtgnkvgtiggvgyelwadsgnnsatfysdgsfsctfqnagd
ylcrsglsfdstktpsqigrmkadfklvkqnssnvgysyvgvygwtrsplvayyivdnwl
spfppgdwvgnkkhgsftidgaqytvyentrtgpsidgdttfnqyfsirqqardcgtidi
sahfdqweklgmtmgklheakvlgeagnvnggasgtadfpyakvyigd

SCOPe Domain Coordinates for d3wp6a_:

Click to download the PDB-style file with coordinates for d3wp6a_.
(The format of our PDB-style files is described here.)

Timeline for d3wp6a_: