Lineage for d3w9ta2 (3w9t A:151-283)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401663Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2401664Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2401722Protein Hemolytic lectin CEL-III, domains 1 and 2 [110211] (1 species)
  7. 2401723Species Cucumaria echinata [TaxId:40245] [110212] (4 PDB entries)
    Uniprot Q868M7 11-442
  8. 2401737Domain d3w9ta2: 3w9t A:151-283 [237902]
    Other proteins in same PDB: d3w9ta3, d3w9ta4, d3w9tb3, d3w9tb4, d3w9tc3, d3w9tc4, d3w9td3, d3w9td4, d3w9te3, d3w9te4, d3w9tf3, d3w9tf4, d3w9tg3, d3w9tg4
    automated match to d1vcla2
    complexed with ca, mg, w9t

Details for d3w9ta2

PDB Entry: 3w9t (more details), 2.9 Å

PDB Description: pore-forming cel-iii
PDB Compounds: (A:) hemolytic lectin CEL-III

SCOPe Domain Sequences for d3w9ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w9ta2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]}
pelfygrlrneksdlcldvegsdgkgnvlmyscednldqwfryyengeivnaksgmcldv
egsdgsgnvgiyrcddlrdqmwsrpnaycngdycsflnkesnkcldvsgdqgtgdvgtwq
cdglpdqrfkwvf

SCOPe Domain Coordinates for d3w9ta2:

Click to download the PDB-style file with coordinates for d3w9ta2.
(The format of our PDB-style files is described here.)

Timeline for d3w9ta2: