SCOP 1.57: Domain d2btvh2: 2btv H:121-254

Lineage for d2btvh2 (2btv H:121-254)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)

4. Superfamily b.19.1: Viral protein domain [49818] (3 families)

5. Family b.19.1.1: Top domain of virus capsid protein [49819] (2 proteins)

6. Protein Virus capsid protein vp7 (BTV-10 vp7), central (top) domain [49820] (2 species)

7. Species Bluetongue virus [TaxId:40051] [49821] (2 PDB entries)

8. Domain d2btvh2: 2btv H:121-254 [23789]
   Other proteins in same PDB: d2btva_, d2btvb_, d2btvc1, d2btvd1, d2btve1, d2btvf1, d2btvg1, d2btvh1, d2btvi1, d2btvj1, d2btvp1, d2btvq1, d2btvr1, d2btvs1, d2btvt1

Details for d2btvh2

PDB Entry: 2btv, 3.5 Å

PDB Description: atomic model for bluetongue virus (btv) core

SCOP Domain Sequences for d2btvh2:

Sequence; same for both SEQRES and ATOM records:

>d2btvh2 b.19.1.1 (H:121-254) Virus capsid protein vp7 (BTV-10 vp7), central (top) domain {Bluetongue virus}
parqpygffleteetfqpgrwfmraaqaatavvcgpdmiqvslnagargdvqqifqgrnd
pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvrnptqqn
amvqiqvvfyismd

Timeline for d2btvh2:

• d2btvh2 first appeared (with stable ids) in SCOP 1.55
  
• d2btvh2 appears in SCOP 1.59
  
• d2btvh2 appears in the current release, SCOPe 2.08