SCOP 1.57: Domain d2btvj1: 2btv J:1-120,J:255-349

Lineage for d2btvj1 (2btv J:1-120,J:255-349)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)

4. Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (2 families)

5. Family a.115.1.1: Bluetongue virus capsid protein vp7 (BTV-10 vp7) [48346] (1 protein)

6. Protein Bluetongue virus capsid protein vp7 (BTV-10 vp7) [48347] (1 species)

7. Species Bluetongue virus [TaxId:40051] [48348] (2 PDB entries)

8. Domain d2btvj1: 2btv J:1-120,J:255-349 [19096]
   Other proteins in same PDB: d2btva_, d2btvb_, d2btvc2, d2btvd2, d2btve2, d2btvf2, d2btvg2, d2btvh2, d2btvi2, d2btvj2, d2btvp2, d2btvq2, d2btvr2, d2btvs2, d2btvt2

Details for d2btvj1

PDB Entry: 2btv, 3.5 Å

PDB Description: atomic model for bluetongue virus (btv) core

SCOP Domain Sequences for d2btvj1:

Sequence; same for both SEQRES and ATOM records:

>d2btvj1 a.115.1.1 (J:1-120,J:255-349) Bluetongue virus capsid protein vp7 (BTV-10 vp7) {Bluetongue virus}
mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
Xktlnqypaltaeifnvysfrdhtwhglrtairnrttlpnmlppifppndrdsiltllll
stladvytvlrpefamhgvnpmpgpltaaiaraayv

Timeline for d2btvj1:

• d2btvj1 first appeared (with stable ids) in SCOP 1.55
  
• d2btvj1 appears in SCOP 1.59
  
• d2btvj1 appears in the current release, SCOPe 2.08