SCOPe 2.03: Domain d4bmba_: 4bmb A:

Lineage for d4bmba_ (4bmb A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (29 PDB entries)

8. Domain d4bmba_: 4bmb A: [237762]
   automated match to d2zhma_
   complexed with gol, lat, na, zn

Details for d4bmba_

PDB Entry: 4bmb, 1.35 Å

PDB Description: crystal structure of the n terminal domain of human galectin 8

PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d4bmba_:

Sequence; same for both SEQRES and ATOM records:

>d4bmba_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradva
fhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkht
llyghrigpekidtlgiygkvnihsigfsf

Timeline for d4bmba_:

• d4bmba_ is new in SCOPe 2.03-stable
  
• d4bmba_ appears in SCOPe 2.04
  
• d4bmba_ appears in the current release, SCOPe 2.08