| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.98: BLIP-like [55647] (2 superfamilies) alpha(2)-beta(4); 2 layers: alpha/beta |
Superfamily d.98.2: BT0923-like [160574] (2 families) ![]() Duplication: tandem repeat of two similar structural subdomains, which associate like the BLIP repeats but differ from them by transposition of the helices |
| Family d.98.2.0: automated matches [195801] (1 protein) not a true family |
| Protein automated matches [195802] (3 species) not a true protein |
| Species Bacteroides caccae [TaxId:411901] [237729] (1 PDB entry) |
| Domain d4poib_: 4poi B: [237730] automated match to d3db7a_ |
PDB Entry: 4poi (more details), 2.3 Å
SCOPe Domain Sequences for d4poib_:
Sequence, based on SEQRES records: (download)
>d4poib_ d.98.2.0 (B:) automated matches {Bacteroides caccae [TaxId: 411901]}
tkdmnqlplparnfinrhftkpevshikidkemleatkyevlltdgteiefdskgnweev
sarkgqvipasivpnfavdylkahnfaaegvtkverdrkgyevelstgvsfkfdkkgkfv
ka
>d4poib_ d.98.2.0 (B:) automated matches {Bacteroides caccae [TaxId: 411901]}
tkdmlplparnfinrhftkpevshikidkemleatkyevlltdgteiefdskgnweevsa
rkgqvipasivpnfavdylkahnfaaegvtkverdrkgyevelstgvsfkfdkkgkfvka
Timeline for d4poib_: