SCOPe 2.06: Domain d4poib_: 4poi B:

Lineage for d4poib_ (4poi B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.98: BLIP-like [55647] (2 superfamilies)
   alpha(2)-beta(4); 2 layers: alpha/beta

4. Superfamily d.98.2: BT0923-like [160574] (2 families)
   Duplication: tandem repeat of two similar structural subdomains, which associate like the BLIP repeats but differ from them by transposition of the helices

5. Family d.98.2.0: automated matches [195801] (1 protein)
   not a true family

6. Protein automated matches [195802] (3 species)
   not a true protein

7. Species Bacteroides caccae [TaxId:411901] [237729] (1 PDB entry)

8. Domain d4poib_: 4poi B: [237730]
   automated match to d3db7a_

Details for d4poib_

PDB Entry: 4poi, 2.3 Å

PDB Description: crystal structure of a putative periplasmic protein (baccac_02096) from bacteroides caccae atcc 43185 at 2.30 a resolution

PDB Compounds: (B:) Putative periplasmic protein

SCOPe Domain Sequences for d4poib_:

Sequence, based on SEQRES records:

>d4poib_ d.98.2.0 (B:) automated matches {Bacteroides caccae [TaxId: 411901]}
tkdmnqlplparnfinrhftkpevshikidkemleatkyevlltdgteiefdskgnweev
sarkgqvipasivpnfavdylkahnfaaegvtkverdrkgyevelstgvsfkfdkkgkfv
ka

Sequence, based on observed residues (ATOM records):

>d4poib_ d.98.2.0 (B:) automated matches {Bacteroides caccae [TaxId: 411901]}
tkdmlplparnfinrhftkpevshikidkemleatkyevlltdgteiefdskgnweevsa
rkgqvipasivpnfavdylkahnfaaegvtkverdrkgyevelstgvsfkfdkkgkfvka

Timeline for d4poib_:

• d4poib_ first appeared in SCOPe 2.03
  
• d4poib_ appears in SCOPe 2.05
  
• d4poib_ appears in SCOPe 2.07
  
• d4poib_ appears in the current release, SCOPe 2.08