Lineage for d4poib_ (4poi B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663250Fold d.98: BLIP-like [55647] (2 superfamilies)
    alpha(2)-beta(4); 2 layers: alpha/beta
  4. 1663290Superfamily d.98.2: BT0923-like [160574] (2 families) (S)
    Duplication: tandem repeat of two similar structural subdomains, which associate like the BLIP repeats but differ from them by transposition of the helices
  5. 1663302Family d.98.2.0: automated matches [195801] (1 protein)
    not a true family
  6. 1663303Protein automated matches [195802] (3 species)
    not a true protein
  7. 1663304Species Bacteroides caccae [TaxId:411901] [237729] (1 PDB entry)
  8. 1663306Domain d4poib_: 4poi B: [237730]
    automated match to d3db7a_

Details for d4poib_

PDB Entry: 4poi (more details), 2.3 Å

PDB Description: crystal structure of a putative periplasmic protein (baccac_02096) from bacteroides caccae atcc 43185 at 2.30 a resolution
PDB Compounds: (B:) Putative periplasmic protein

SCOPe Domain Sequences for d4poib_:

Sequence, based on SEQRES records: (download)

>d4poib_ d.98.2.0 (B:) automated matches {Bacteroides caccae [TaxId: 411901]}
tkdmnqlplparnfinrhftkpevshikidkemleatkyevlltdgteiefdskgnweev
sarkgqvipasivpnfavdylkahnfaaegvtkverdrkgyevelstgvsfkfdkkgkfv
ka

Sequence, based on observed residues (ATOM records): (download)

>d4poib_ d.98.2.0 (B:) automated matches {Bacteroides caccae [TaxId: 411901]}
tkdmlplparnfinrhftkpevshikidkemleatkyevlltdgteiefdskgnweevsa
rkgqvipasivpnfavdylkahnfaaegvtkverdrkgyevelstgvsfkfdkkgkfvka

SCOPe Domain Coordinates for d4poib_:

Click to download the PDB-style file with coordinates for d4poib_.
(The format of our PDB-style files is described here.)

Timeline for d4poib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4poia_