SCOPe 2.04: Domain d4nyjq_: 4nyj Q:

Lineage for d4nyjq_ (4nyj Q:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (104 PDB entries)
   Uniprot Q6P716

8. Domain d4nyjq_: 4nyj Q: [237703]
   Other proteins in same PDB: d4nyjs_
   automated match to d1nvvq_
   complexed with 2pz, gnp, mg

Details for d4nyjq_

PDB Entry: 4nyj, 2.85 Å

PDB Description: Approach for Targeting Ras with Small Molecules that Activate SOS-Mediated Nucleotide Exchange

PDB Compounds: (Q:) gtpase hras

SCOPe Domain Sequences for d4nyjq_:

Sequence; same for both SEQRES and ATOM records:

>d4nyjq_ c.37.1.8 (Q:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeasamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d4nyjq_:

• d4nyjq_ first appeared in SCOPe 2.03
  
• d4nyjq_ appears in SCOPe 2.05
  
• d4nyjq_ appears in the current release, SCOPe 2.08