SCOPe 2.08: Domain d4ntwb_: 4ntw B:

Lineage for d4ntwb_ (4ntw B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.0: automated matches [191505] (1 protein)
   not a true family

6. Protein automated matches [190829] (14 species)
   not a true protein

7. Species Micrurus tener [TaxId:1114302] [237085] (3 PDB entries)

8. Domain d4ntwb_: 4ntw B: [237687]
   Other proteins in same PDB: d4ntwc_
   automated match to d4ntxb_
   complexed with cl, na, nag, p6g

Details for d4ntwb_

PDB Entry: 4ntw, 2.07 Å

PDB Description: structure of acid-sensing ion channel in complex with snake toxin

PDB Compounds: (B:) Neurotoxin MitTx-alpha

SCOPe Domain Sequences for d4ntwb_:

Sequence; same for both SEQRES and ATOM records:

>d4ntwb_ g.8.1.0 (B:) automated matches {Micrurus tener [TaxId: 1114302]}
eirpafcyedppffqkcgafvdsyyfnrsritcvhffygqcdvnqnhfttmsecnrvchg

Timeline for d4ntwb_:

• d4ntwb_ first appeared in SCOPe 2.03
  
• d4ntwb_ appears in SCOPe 2.07