Lineage for d4nlia_ (4nli A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551687Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1551688Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1551689Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1552080Protein automated matches [190163] (13 species)
    not a true protein
  7. 1552165Species Sheep (Ovis aries) [TaxId:9940] [237679] (3 PDB entries)
  8. 1552170Domain d4nlia_: 4nli A: [237680]
    automated match to d3ueva_
    complexed with so4

Details for d4nlia_

PDB Entry: 4nli (more details), 1.9 Å

PDB Description: crystal structure of sheep beta-lactoglobulin (space group p3121)
PDB Compounds: (A:) Beta-lactoglobulin-1/B

SCOPe Domain Sequences for d4nlia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nlia_ b.60.1.1 (A:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
iivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegnleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevdnealekfdkalkalpmhirlafnptqlegqchv

SCOPe Domain Coordinates for d4nlia_:

Click to download the PDB-style file with coordinates for d4nlia_.
(The format of our PDB-style files is described here.)

Timeline for d4nlia_: