SCOPe 2.03: Domain d4ms6a1: 4ms6 A:3-208

Lineage for d4ms6a1 (4ms6 A:3-208)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.98: Leukotriene A4 hydrolase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Leukotriene A4 hydrolase N-terminal domain [63737] (1 family)

5. Family b.98.1.1: Leukotriene A4 hydrolase N-terminal domain [63738] (1 protein)

6. Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63740] (44 PDB entries)
   Uniprot P09960

8. Domain d4ms6a1: 4ms6 A:3-208 [237658]
   Other proteins in same PDB: d4ms6a2, d4ms6a3
   automated match to d2vj8a2
   complexed with 28t, acy, yb, zn

Details for d4ms6a1

PDB Entry: 4ms6, 1.72 Å

PDB Description: Human Leukotriene A4 Hydrolase in complex with Pro-Gly-Pro analogue

PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d4ms6a1:

Sequence; same for both SEQRES and ATOM records:

>d4ms6a1 b.98.1.1 (A:3-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltie
kvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeq
tsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdpe
dpsrkiykfiqkvpipcylialvvga

Timeline for d4ms6a1:

• d4ms6a1 is new in SCOPe 2.03-stable
  
• d4ms6a1 appears in SCOPe 2.04
  
• d4ms6a1 appears in the current release, SCOPe 2.08