Lineage for d4ms6a1 (4ms6 A:3-208)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409030Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2409031Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2409032Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 protein domains)
  6. 2409048Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)
  7. 2409049Species Human (Homo sapiens) [TaxId:9606] [63740] (56 PDB entries)
    Uniprot P09960
  8. 2409068Domain d4ms6a1: 4ms6 A:3-208 [237658]
    Other proteins in same PDB: d4ms6a2, d4ms6a3
    automated match to d2vj8a2
    complexed with 28t, acy, yb, zn

Details for d4ms6a1

PDB Entry: 4ms6 (more details), 1.72 Å

PDB Description: Human Leukotriene A4 Hydrolase in complex with Pro-Gly-Pro analogue
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d4ms6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ms6a1 b.98.1.1 (A:3-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltie
kvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeq
tsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdpe
dpsrkiykfiqkvpipcylialvvga

SCOPe Domain Coordinates for d4ms6a1:

Click to download the PDB-style file with coordinates for d4ms6a1.
(The format of our PDB-style files is described here.)

Timeline for d4ms6a1: