Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
Protein automated matches [226870] (22 species) not a true protein |
Species Brucella abortus [TaxId:235] [228298] (4 PDB entries) |
Domain d4fxuc2: 4fxu C:97-197 [237610] automated match to d4e0fa2 |
PDB Entry: 4fxu (more details), 1.9 Å
SCOPe Domain Sequences for d4fxuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fxuc2 b.43.4.0 (C:97-197) automated matches {Brucella abortus [TaxId: 235]} emgghlvfghvdgqaeiverkdegdavrftlrapeelapfiaqkgsvaldgtsltvngvn anefdvllirhslevttwgerkagdkvnieidqlaryaarl
Timeline for d4fxuc2:
View in 3D Domains from other chains: (mouse over for more information) d4fxua1, d4fxua2, d4fxub1, d4fxub2 |