Lineage for d3w7gb_ (3w7g B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2436513Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2436558Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 2436667Species Trypanosoma cruzi [TaxId:353153] [254868] (49 PDB entries)
  8. 2436701Domain d3w7gb_: 3w7g B: [237505]
    automated match to d3w1aa_
    complexed with fmn, gol, nco, w7g

Details for d3w7gb_

PDB Entry: 3w7g (more details), 1.55 Å

PDB Description: structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-013
PDB Compounds: (B:) Dihydroorotate dehydrogenase (fumarate)

SCOPe Domain Sequences for d3w7gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w7gb_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Trypanosoma cruzi [TaxId: 353153]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie

SCOPe Domain Coordinates for d3w7gb_:

Click to download the PDB-style file with coordinates for d3w7gb_.
(The format of our PDB-style files is described here.)

Timeline for d3w7gb_: