![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein) duplication: consists of three domains of this fold |
![]() | Protein DNA polymerase III, beta subunit [55981] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [55982] (30 PDB entries) Uniprot P00583 |
![]() | Domain d4pnua1: 4pnu A:1-122 [237451] automated match to d3d1ga1 complexed with 2vd, ca, cl, peg |
PDB Entry: 4pnu (more details), 1.9 Å
SCOPe Domain Sequences for d4pnua1:
Sequence, based on SEQRES records: (download)
>d4pnua1 d.131.1.1 (A:1-122) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]} mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld dw
>d4pnua1 d.131.1.1 (A:1-122) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]} mkftverehllkplqqvsgpllpilgnlllqvadgtlsltgtdlememvarvalvqphep gattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnlddw
Timeline for d4pnua1: