SCOPe 2.07: Domain d4ovfa3: 4ovf A:245-364

Lineage for d4ovfa3 (4ovf A:245-364)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
   duplication: consists of three domains of this fold

6. Protein DNA polymerase III, beta subunit [55981] (2 species)

7. Species Escherichia coli [TaxId:562] [55982] (30 PDB entries)
   Uniprot P00583

8. Domain d4ovfa3: 4ovf A:245-364 [237442]
   automated match to d3d1ga3
   complexed with 2vg, ca, cl, peg, pg4, pge

Details for d4ovfa3

PDB Entry: 4ovf, 2.05 Å

PDB Description: e. coli sliding clamp in complex with (r)-6-chloro-2,3,4,9-tetrahydro- 1h-carbazole-2-carboxylic acid

PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d4ovfa3:

Sequence; same for both SEQRES and ATOM records:

>d4ovfa3 d.131.1.1 (A:245-364) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
rrvlpknpdkhleagcdllkqafaraailsnekfrgvrlyvsenqlkitannpeqeeaee
ildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayvvmpm

Timeline for d4ovfa3:

• d4ovfa3 first appeared in SCOPe 2.03
  
• d4ovfa3 appears in SCOPe 2.06
  
• d4ovfa3 appears in the current release, SCOPe 2.08