SCOPe 2.06: Domain d4m34b_: 4m34 B:

Lineage for d4m34b_ (4m34 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (39 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [188322] (14 PDB entries)

8. Domain d4m34b_: 4m34 B: [237293]
   automated match to d2z90a_
   complexed with cl, fe2, mg; mutant

Details for d4m34b_

PDB Entry: 4m34, 2.05 Å

PDB Description: Crystal structure of gated-pore mutant D138H of second DNA-Binding protein under starvation from Mycobacterium smegmatis

PDB Compounds: (B:) Putative starvation-induced DNA protecting protein/Ferritin and Dps

SCOPe Domain Sequences for d4m34b_:

Sequence, based on SEQRES records:

>d4m34b_ a.25.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelvd
faregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvdt
irrvhdavdaedpstahllhglidglekqawlirsenrkv

Sequence, based on observed residues (ATOM records):

>d4m34b_ a.25.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sarrtesigfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelvdfa
regsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvdtir
rvhdavdaedpstahllhglidglekqawlirsenrkv

Timeline for d4m34b_:

• d4m34b_ first appeared in SCOPe 2.03
  
• d4m34b_ appears in SCOPe 2.05
  
• d4m34b_ appears in SCOPe 2.07
  
• d4m34b_ appears in the current release, SCOPe 2.08